PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 105aa    MW: 12291.1 Da    PI: 10.3825
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72249.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+  +++a k++G   W +I +++g ++++ q++s+ qk+
       EPS72249.1 24 RERWTEEEHTSFLEALKLYGRA-WQRIEEHIG-TKSAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.44E-171874IPR009057Homeodomain-like
PROSITE profilePS5129417.751973IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-92170IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-172271IPR006447Myb domain, plants
SMARTSM007172.3E-112371IPR001005SANT/Myb domain
PfamPF002491.8E-132467IPR001005SANT/Myb domain
CDDcd001673.64E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MDPYSSGEDH VIKARKPYTI TKQRERWTEE EHTSFLEALK LYGRAWQRIE EHIGTKSAVQ  60
IRSHAQKFFT KLEKEAIVKG VGHALDIEIP PPRPKRKPSN PYPRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093093.13e-53PREDICTED: protein LHY-like
SwissprotP929732e-43CCA1_ARATH; Protein CCA1
SwissprotQ6R0H12e-43LHY_ARATH; Protein LHY
TrEMBLS8CXQ08e-73S8CXQ0_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc10g005080.2.15e-50(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97101315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.42e-43MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]